Une adhésion de la meilleure qualité pour les fournisseurs de plus haut niveau.

Les produits que nous avons fournis sont pour la recherche ou la production de laboratoire seulement, interdit pour les consommations privées directement.

 

 

Accueil
produits
A propos de nous
Visite de l'usine
Contrôle de la qualité
nous contacter
Demande de soumission
Accueil ProduitsRecherche d'hormone de peptide

FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI

Certificat
De bonne qualité Api de peptide en ventes
De bonne qualité Api de peptide en ventes
Bon prix. Le produit est de loin le meilleur, très heureux et heureux, achètera encore.

—— ****** S Royaume-Uni de K

La grande pureté, expédition rapide, a recommandé cette société.

—— État uni par t de ***** de Perry

Grand service j'ai été maintenu au courant au sujet de mon ordre que le temps plein remercie Jones.

—— **** Y Australie d'E

Je suis en ligne une discussion en ligne

FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI

Chine FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI fournisseur
FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI fournisseur FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI fournisseur FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI fournisseur

Image Grand :  FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI

Détails sur le produit:

Lieu d'origine: La Chine
Nom de marque: MOBELBIO
Certification: ISO,SGS

Conditions de paiement et expédition:

Quantité de commande min: 10mg
Prix: According to order amounts
Détails d'emballage: Fioles ou bouteille
Délai de livraison: dans les 3-5 jours
Conditions de paiement: T/T.
Capacité d'approvisionnement: jour 1gram/
Contact Now
Description de produit détaillée
Pureté: 97 % min Apparence: poudre blanche

 

  • Nom de produit : FOXO4 D-rétro-Inverso peptide (DRI)
  • Ordre
    H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
  • Code de trois lettres
    H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
  • Longueur (aa) : 46
  • Pureté de peptide (CLHP) : Minute de 97%
  • Formule moléculaire : C228 H388 N86 O64
  • Poids moléculaire : 5358,05
  • Source : Synthétique
  • Qualité : Voir le COA, milliseconde, CLHP, rapports de MSDS
  • Descriptions de FOXO4 DRI
  • FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI
    Le D-rétro-Inverso peptide FOXO4, également connu sous le nom de le peptide de FOXO4 DRI était rapporté la première fois dans “l'Apoptosis visé des cellules sénescentes reconstitue l'homéostasie de tissu en réponse à Chemotoxicity et à vieillissement” par le peptide de Baar et autres FOXO4 DRI comportant la séquence des acides aminés : LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, où les acides aminés dans ladite séquence des acides aminés sont les résidus acides D-aminés. Le D-rétro-Inverso peptide FOXO4 induit sélectivement l'apoptosis des effets sénescents d'inverses de cellules de chemotoxicity et de vieillissement chez les souris.
  • Directives de stockage
    Dans le meilleur des cas FOXO4 le D-rétro-Inverso peptide (DRI) devrait être stocké dans un congélateur à ou en dessous de -9C. FOXO4 le D-rétro-Inverso peptide (DRI) devrait être frigorifié après reconstitution. 
  •  
  • Remarques : Les produits est limités dans le laboratoire, interdit pour privé consomment directement.
  •  

Coordonnées
HANGZHOU MOBEL BIOTECHNOLOGY CO.,LTD

Personne à contacter: admin

Envoyez votre demande directement à nous (0 / 3000)