Une adhésion de la meilleure qualité pour les fournisseurs de plus haut niveau.

Les produits que nous avons fournis sont pour la recherche ou la production de laboratoire seulement, interdit pour les consommations privées directement.

 

 

Accueil
produits
A propos de nous
Visite de l'usine
Contrôle de la qualité
nous contacter
Demande de soumission
Accueil Produits

Recherche d'hormone de peptide

Certificat
De bonne qualité Api de peptide en ventes
De bonne qualité Api de peptide en ventes
Bon prix. Le produit est de loin le meilleur, très heureux et heureux, achètera encore.

—— ****** S Royaume-Uni de K

La grande pureté, expédition rapide, a recommandé cette société.

—— État uni par t de ***** de Perry

Grand service j'ai été maintenu au courant au sujet de mon ordre que le temps plein remercie Jones.

—— **** Y Australie d'E

Je suis en ligne une discussion en ligne

Recherche d'hormone de peptide

(39)
Chine Recherche GLYX 13 CAS numéro 117928-94-6 d'hormone de peptide de synthèse de Powerd usine

Recherche GLYX 13 CAS numéro 117928-94-6 d'hormone de peptide de synthèse de Powerd

Nom de produit GLYX-13 CAS non. 863288-34-0 Synonyme Trifluoroacetate de L-Threonyl-L-prolyl-L-prolyl-L-threoninamide ; Thr-Pro-Pro-Thr-NH2 trifluoroacetate, Rapastinel, trifluoroacetate de TPPT-amide Pureté ... Read More
2019-01-22 13:54:18
Chine Neuroprotective N - intermédiaires pharmaceutiques Cas 80714-61-0 de peptide de Semax d'acétyle usine

Neuroprotective N - intermédiaires pharmaceutiques Cas 80714-61-0 de peptide de Semax d'acétyle

Neuroprotective N - pureté de Cas 80714-61-0 99% de peptide de Semax d'acétyle Peptide de Semax/ACTHS intermédiaires pharmaceutiques (4-10) l'information 1.Basic : Nom : Peptide de Semax Synonyme : ACTHS (4-10... Read More
2019-01-22 13:54:17
Chine FOXO4- les fioles de la pureté 10mg de l'acide aminé 98% de peptide de DRI libèrent l'expédition usine

FOXO4- les fioles de la pureté 10mg de l'acide aminé 98% de peptide de DRI libèrent l'expédition

RENARD chaud de la vente 2018 04DRI/Senolytics Le D-rétro-Inverso peptide FOXO4, également connu sous le nom de le peptide de FOXO4 DRI était rapporté la première fois dans “l'Apoptosis visé des cellules s... Read More
2019-01-22 13:54:15
Chine Anticorps humain bloquant des fioles du peptide Foxo4 avec la grande pureté embarquant librement usine

Anticorps humain bloquant des fioles du peptide Foxo4 avec la grande pureté embarquant librement

Source Humain, de recombinaison Immunogène 15 acides aminés près du terminus aminé de FOXO4 humain Formulation Le peptide est fourni en tant que solution de 200 µg/ml dans PBS pH 7,2 (10 millimètres NaH de ₄ de ... Read More
2019-01-22 13:54:16
Chine Suppléments d'hormone de croissance humaine de HGH 191AA Cas 12629-01-5 pour le bodybuilding usine

Suppléments d'hormone de croissance humaine de HGH 191AA Cas 12629-01-5 pour le bodybuilding

Suppléments d'hormone de croissance humaine de HGH 191AA Cas 12629-01-5 pour le bodybuilding Nom de produit : hormone de croissance humaine HGH No. d'EINECS : 235-735-8 CAS : 12629-01-5 Caractéristique : ... Read More
2019-03-01 14:20:59
Chine FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI usine

FOXO4 D - rétro - pureté du peptide FOXO4 DRI 98% de recherches d'Inverso DRI

Nom de produit : FOXO4 D-rétro-Inverso peptide (DRI) Ordre H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH Code de trois lettres H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D... Read More
2019-01-22 13:54:15
Chine Le bleu complète des fioles de l'hormone de croissance humaine 10iu d'injection de HGH 191AA pour des suppléments de bodybuilding usine

Le bleu complète des fioles de l'hormone de croissance humaine 10iu d'injection de HGH 191AA pour des suppléments de bodybuilding

Description : No. d'EINECS : 235-735-8 CAS : 12629-01-5 Caractéristique : bioactivité élevée, pureté de forte stabilité et grande, hgh de 191 aa Formule moléculaire : C990H1528N262O300S7 Poids de formule : ... Read More
2019-01-22 13:54:14
Chine La TA -2 CAS d'acétate de Melanotan II 121062-08-6 fioles 10mg pour le bronzage de peau usine

La TA -2 CAS d'acétate de Melanotan II 121062-08-6 fioles 10mg pour le bronzage de peau

Nom de produit : Melanotan2 L'autre nom : Melanotan 2, MT-II Synonymes : [Asp-son-d-Phe-Arg-Trp-Lys] - NH2 C.A.-Nle-cyclo CAS # : 121062-08-6 Pureté : 99% mn. Formule moléculaire : C50H69N15O9 Poids moléculaire ... Read More
2019-02-19 10:30:06
Chine Le bleu de fioles de Somatropin GH 191AA 10iu complète l'aperçu gratuit de norme de BP USP usine

Le bleu de fioles de Somatropin GH 191AA 10iu complète l'aperçu gratuit de norme de BP USP

Nom : r-hectogramme Aspect : Poudre lyophilisée par blanc Spécifications : 10 iu/vial 10vial/kit 100iu/kit Actions : En stock Capacité d'approvisionnement : Le volume La livraison : FedeEx, SME, HKEMS, TNT, DHL... Read More
2019-03-01 14:21:05
Chine Prix usine de bronzage de la pureté 98% de Myristoyl Tetrapeptide-20 Dermapep T430 de peptide d'individu de peau usine

Prix usine de bronzage de la pureté 98% de Myristoyl Tetrapeptide-20 Dermapep T430 de peptide d'individu de peau

Myristoyl Tetrapeptide-20 l'information 1.Basic : Nom d'INCI : Myristoyl Tetrapeptide-20 Référence : Dermapep T430 Pureté : >98% Source : synthétique Formulation : disponible pour votre référence, svp contactez... Read More
2019-01-22 13:54:13
Page 1 of 4|< 1 2 3 4 >|